Entering edit mode
I am reading about a new package and I am interested in plotting logo of a protein sequence. The problem is that the author did not specify how one can convert the sequence to number
Here is an example sequence
seq <- "MGLRYSIYIENPLSSPSSSYKSINDPLFHSQHRSQKNVSFITYGCRHCKTHLSSSFQIIS
RDYRGRTGTAYLMNKVVNVVEGKVEQRRMLTGDYLVCDILCHWCKRNVGWKYLQSSNDDQ
QYKEGKFILELKNICKCT"
is there anyone who could help me plot it using this package or any other package